F3 monoclonal antibody, clone CL3805 View larger

F3 monoclonal antibody, clone CL3805

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of F3 monoclonal antibody, clone CL3805

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about F3 monoclonal antibody, clone CL3805

Brand: Abnova
Reference: MAB15693
Product name: F3 monoclonal antibody, clone CL3805
Product description: Mouse monoclonal antibody raised against partial recombinant human F3.
Clone: CL3805
Isotype: IgG1
Gene id: 2152
Gene name: F3
Gene alias: CD142|TF|TFA
Gene description: coagulation factor III (thromboplastin, tissue factor)
Immunogen: Recombinant protein corresponding to human F3.
Immunogen sequence/protein sequence: VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN
Protein accession: P13726
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15693-46-4-1.jpg
Application image note: Western Blot (Cell lysate) analysis of A-431 cell lysate.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy F3 monoclonal antibody, clone CL3805 now

Add to cart