FN1 monoclonal antibody, clone CL3730 View larger

FN1 monoclonal antibody, clone CL3730

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FN1 monoclonal antibody, clone CL3730

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about FN1 monoclonal antibody, clone CL3730

Brand: Abnova
Reference: MAB15688
Product name: FN1 monoclonal antibody, clone CL3730
Product description: Mouse monoclonal antibody raised against partial recombinant human FN1.
Clone: CL3730
Isotype: IgG1
Gene id: 2335
Gene name: FN1
Gene alias: CIG|DKFZp686F10164|DKFZp686H0342|DKFZp686I1370|DKFZp686O13149|ED-B|FINC|FN|FNZ|GFND|GFND2|LETS|MSF
Gene description: fibronectin 1
Immunogen: Recombinant protein corresponding to human FN1.
Immunogen sequence/protein sequence: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG
Protein accession: P02751
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15688-46-90-1.jpg
Application image note: Western Blot (Cell lysate) analysis of U-87 MG cell lysate.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy FN1 monoclonal antibody, clone CL3730 now

Add to cart