Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P |
Brand: | Abnova |
Reference: | MAB15678 |
Product name: | CD68 monoclonal antibody, clone CL1338 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human CD68. |
Clone: | CL1338 |
Isotype: | IgG1 |
Gene id: | 968 |
Gene name: | CD68 |
Gene alias: | DKFZp686M18236|GP110|SCARD1 |
Gene description: | CD68 molecule |
Immunogen: | Recombinant protein corresponding to human CD68. |
Immunogen sequence/protein sequence: | SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG |
Protein accession: | P34810 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with CD68 monoclonal antibody, clone CL1338 (Cat # MAB15678) shows strong immunoreactivity in Kupffer cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |