ERCC1 monoclonal antibody, clone CL1249 View larger

ERCC1 monoclonal antibody, clone CL1249

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERCC1 monoclonal antibody, clone CL1249

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P

More info about ERCC1 monoclonal antibody, clone CL1249

Brand: Abnova
Reference: MAB15676
Product name: ERCC1 monoclonal antibody, clone CL1249
Product description: Mouse monoclonal antibody raised against partial recombinant human ERCC1.
Clone: CL1249
Isotype: IgG2a
Gene id: 2067
Gene name: ERCC1
Gene alias: COFS4|UV20
Gene description: excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence)
Immunogen: Recombinant protein corresponding to human ERCC1.
Immunogen sequence/protein sequence: LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Protein accession: P07992
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15676-48-252-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver cancer with ERCC1 monoclonal antibody, clone CL1249 (Cat # MAB15676) shows strong nuclear positivity in tumor cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ERCC1 monoclonal antibody, clone CL1249 now

Add to cart