ESR1 monoclonal antibody, clone CL1196 View larger

ESR1 monoclonal antibody, clone CL1196

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ESR1 monoclonal antibody, clone CL1196

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about ESR1 monoclonal antibody, clone CL1196

Brand: Abnova
Reference: MAB15674
Product name: ESR1 monoclonal antibody, clone CL1196
Product description: Mouse monoclonal antibody raised against partial recombinant human ESR1.
Clone: CL1196
Isotype: IgG1
Gene id: 2099
Gene name: ESR1
Gene alias: DKFZp686N23123|ER|ESR|ESRA|Era|NR3A1
Gene description: estrogen receptor 1
Immunogen: Recombinant protein corresponding to human ESR1.
Immunogen sequence/protein sequence: FGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTID
Protein accession: P03372
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15674-46-multi-1.jpg
Application image note: Western Blot analysis of Lane 1: MCF-7 and Lane 2: SK-BR-3 cell lysates with ESR1 monoclonal antibody, clone CL1196 (Cat # MAB15674).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ESR1 monoclonal antibody, clone CL1196 now

Add to cart