CDH1 monoclonal antibody, clone CL1172 View larger

CDH1 monoclonal antibody, clone CL1172

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDH1 monoclonal antibody, clone CL1172

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about CDH1 monoclonal antibody, clone CL1172

Brand: Abnova
Reference: MAB15672
Product name: CDH1 monoclonal antibody, clone CL1172
Product description: Mouse monoclonal antibody raised against partial recombinant human CDH1.
Clone: CL1172
Isotype: IgG1
Gene id: 999
Gene name: CDH1
Gene alias: Arc-1|CD324|CDHE|ECAD|LCAM|UVO
Gene description: cadherin 1, type 1, E-cadherin (epithelial)
Immunogen: Recombinant protein corresponding to human CDH1.
Immunogen sequence/protein sequence: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA
Protein accession: P12830
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15672-46-multi-1.jpg
Application image note: Western Blot analysis of Lane 1: MCF-7, Lane 2: SK-BR-3 and Lane 3: HeLa cell lysates with CDH1 monoclonal antibody, clone CL1172 (Cat # MAB15672).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CDH1 monoclonal antibody, clone CL1172 now

Add to cart