DIAPH2 monoclonal antibody, clone CL1111 View larger

DIAPH2 monoclonal antibody, clone CL1111

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DIAPH2 monoclonal antibody, clone CL1111

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about DIAPH2 monoclonal antibody, clone CL1111

Brand: Abnova
Reference: MAB15666
Product name: DIAPH2 monoclonal antibody, clone CL1111
Product description: Mouse monoclonal antibody raised against partial recombinant human DIAPH2.
Clone: CL1111
Isotype: IgG1
Gene id: 1730
Gene name: DIAPH2
Gene alias: DIA|DIA2|DRF2|FLJ11167|POF|POF2
Gene description: diaphanous homolog 2 (Drosophila)
Immunogen: Recombinant protein corresponding to human DIAPH2.
Immunogen sequence/protein sequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
Protein accession: O60879
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15666-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with DIAPH2 monoclonal antibody, clone CL1111 (Cat # MAB15666).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DIAPH2 monoclonal antibody, clone CL1111 now

Add to cart