RHOT1 monoclonal antibody, clone CL1095 View larger

RHOT1 monoclonal antibody, clone CL1095

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOT1 monoclonal antibody, clone CL1095

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P

More info about RHOT1 monoclonal antibody, clone CL1095

Brand: Abnova
Reference: MAB15665
Product name: RHOT1 monoclonal antibody, clone CL1095
Product description: Mouse monoclonal antibody raised against partial recombinant human RHOT1.
Clone: CL1095
Isotype: IgG1
Gene id: 55288
Gene name: RHOT1
Gene alias: ARHT1|FLJ11040|FLJ12633|MIRO-1
Gene description: ras homolog gene family, member T1
Immunogen: Recombinant protein corresponding to human RHOT1.
Immunogen sequence/protein sequence: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
Protein accession: Q8IXI2
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15665-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with RHOT1 monoclonal antibody, clone CL1095 (Cat # MAB15665) shows immunoreactivity in both neuronal cell bodies and neuropil.
Applications: IHC-P
Shipping condition: Dry Ice
Publications: DISC1-dependent Regulation of Mitochondrial Dynamics Controls the Morphogenesis of Complex Neuronal Dendrites.Norkett R, Modi S, Birsa N, Atkin TA, Ivankovic D, Pathania M, Trossbach SV, Korth C, Hirst WD, Kittler JT.
J Biol Chem. 2016 Jan 8;291(2):613-29. doi: 10.1074/jbc.M115.699447. Epub 2015 Nov 9.

Reviews

Buy RHOT1 monoclonal antibody, clone CL1095 now

Add to cart