WHSC1 monoclonal antibody, clone CL1063 View larger

WHSC1 monoclonal antibody, clone CL1063

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WHSC1 monoclonal antibody, clone CL1063

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about WHSC1 monoclonal antibody, clone CL1063

Brand: Abnova
Reference: MAB15663
Product name: WHSC1 monoclonal antibody, clone CL1063
Product description: Mouse monoclonal antibody raised against partial recombinant human WHSC1.
Clone: CL1063
Isotype: IgG2b
Gene id: 7468
Gene name: WHSC1
Gene alias: FLJ23286|KIAA1090|MGC176638|MMSET|NSD2|REIIBP|TRX5|WHS
Gene description: Wolf-Hirschhorn syndrome candidate 1
Immunogen: Recombinant protein corresponding to human WHSC1.
Immunogen sequence/protein sequence: SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD
Protein accession: O96028
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15663-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with WHSC1 monoclonal antibody, clone CL1063 (Cat # MAB15663).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy WHSC1 monoclonal antibody, clone CL1063 now

Add to cart