MACC1 monoclonal antibody, clone CL0856 View larger

MACC1 monoclonal antibody, clone CL0856

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MACC1 monoclonal antibody, clone CL0856

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF

More info about MACC1 monoclonal antibody, clone CL0856

Brand: Abnova
Reference: MAB15655
Product name: MACC1 monoclonal antibody, clone CL0856
Product description: Mouse monoclonal antibody raised against partial recombinant human MACC1.
Clone: CL0856
Isotype: IgG1
Gene id: 346389
Gene name: MACC1
Gene alias: 7A5|SH3BP4L
Gene description: metastasis associated in colon cancer 1
Immunogen: Recombinant protein corresponding to human MACC1.
Immunogen sequence/protein sequence: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
Protein accession: Q6ZN28
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15655-49-4-1.jpg
Application image note: Immunofluorescent staining of A-431 cells with MACC1 monoclonal antibody, clone CL0856 (Cat # MAB15655) (Green) shows specific staining in mitochondria. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MACC1 monoclonal antibody, clone CL0856 now

Add to cart