PGAM5 monoclonal antibody, clone CL0624 View larger

PGAM5 monoclonal antibody, clone CL0624

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGAM5 monoclonal antibody, clone CL0624

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about PGAM5 monoclonal antibody, clone CL0624

Brand: Abnova
Reference: MAB15647
Product name: PGAM5 monoclonal antibody, clone CL0624
Product description: Mouse monoclonal antibody raised against partial recombinant human PGAM5.
Clone: CL0624
Isotype: IgG1
Gene id: 192111
Gene name: PGAM5
Gene alias: BXLBv68|MGC5352
Gene description: phosphoglycerate mutase family member 5
Immunogen: Recombinant protein corresponding to human PGAM5.
Immunogen sequence/protein sequence: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Protein accession: Q96HS1
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15647-46-346-1.jpg
Application image note: Western Blot analysis of RT-4 cell lysate with PGAM5 monoclonal antibody, clone CL0624 (Cat # MAB15647).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PGAM5 monoclonal antibody, clone CL0624 now

Add to cart