NECAB1 monoclonal antibody, clone CL0575 View larger

NECAB1 monoclonal antibody, clone CL0575

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NECAB1 monoclonal antibody, clone CL0575

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about NECAB1 monoclonal antibody, clone CL0575

Brand: Abnova
Reference: MAB15645
Product name: NECAB1 monoclonal antibody, clone CL0575
Product description: Mouse monoclonal antibody raised against partial recombinant human NECAB1.
Clone: CL0575
Isotype: IgG2a
Gene id: 64168
Gene name: NECAB1
Gene alias: EFCBP1|STIP-1
Gene description: N-terminal EF-hand calcium binding protein 1
Immunogen: Recombinant protein corresponding to human NECAB1.
Immunogen sequence/protein sequence: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
Protein accession: Q8N987
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15645-47-51-1.jpg
Application image note: Western Blot analysis of human cerebral cortex tissue lysate with NECAB1 monoclonal antibody, clone CL0575 (Cat # MAB15645).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy NECAB1 monoclonal antibody, clone CL0575 now

Add to cart