Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P |
Brand: | Abnova |
Reference: | MAB15641 |
Product name: | SLC22A2 monoclonal antibody, clone CL0628 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human SLC22A2. |
Clone: | CL0628 |
Isotype: | IgG1 |
Gene id: | 6582 |
Gene name: | SLC22A2 |
Gene alias: | MGC32628|OCT2 |
Gene description: | solute carrier family 22 (organic cation transporter), member 2 |
Immunogen: | Recombinant protein corresponding to human SLC22A2. |
Immunogen sequence/protein sequence: | ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
Protein accession: | O15244 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SLC22A2 monoclonal antibody, clone CL0628 (Cat # MAB15641) shows strong immunoreactivity in renal tubules. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |