STAT3 monoclonal antibody, clone CL0492 View larger

STAT3 monoclonal antibody, clone CL0492

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STAT3 monoclonal antibody, clone CL0492

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about STAT3 monoclonal antibody, clone CL0492

Brand: Abnova
Reference: MAB15636
Product name: STAT3 monoclonal antibody, clone CL0492
Product description: Mouse monoclonal antibody raised against partial recombinant human STAT3.
Clone: CL0492
Isotype: IgG1
Gene id: 6774
Gene name: STAT3
Gene alias: APRF|FLJ20882|HIES|MGC16063
Gene description: signal transducer and activator of transcription 3 (acute-phase response factor)
Immunogen: Recombinant protein corresponding to human STAT3.
Immunogen sequence/protein sequence: GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECA
Protein accession: P40763
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15636-46-346-1.jpg
Application image note: Western Blot analysis of RT-4 cell lysate with STAT3 monoclonal antibody, clone CL0492 (Cat # MAB15636).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy STAT3 monoclonal antibody, clone CL0492 now

Add to cart