APOA4 monoclonal antibody, clone CL0467 View larger

APOA4 monoclonal antibody, clone CL0467

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOA4 monoclonal antibody, clone CL0467

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about APOA4 monoclonal antibody, clone CL0467

Brand: Abnova
Reference: MAB15631
Product name: APOA4 monoclonal antibody, clone CL0467
Product description: Mouse monoclonal antibody raised against partial recombinant human APOA4.
Clone: CL0467
Isotype: IgG1
Gene id: 337
Gene name: APOA4
Gene alias: MGC142154|MGC142156
Gene description: apolipoprotein A-IV
Immunogen: Recombinant protein corresponding to human APOA4.
Immunogen sequence/protein sequence: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Protein accession: P06727
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15631-47-F2-1.jpg
Application image note: Western Blot analysis of human plasma tissue lysate with APOA4 monoclonal antibody, clone CL0467 (Cat # MAB15631).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy APOA4 monoclonal antibody, clone CL0467 now

Add to cart