Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MST1R monoclonal antibody, clone CL0463
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce |
More info about MST1R monoclonal antibody, clone CL0463
| Brand: | Abnova |
| Reference: | MAB15629 |
| Product name: | MST1R monoclonal antibody, clone CL0463 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human MST1R. |
| Clone: | CL0463 |
| Isotype: | IgG1 |
| Gene id: | 4486 |
| Gene name: | MST1R |
| Gene alias: | CD136|CDw136|PTK8|RON |
| Gene description: | macrophage stimulating 1 receptor (c-met-related tyrosine kinase) |
| Immunogen: | Recombinant protein corresponding to human MST1R. |
| Immunogen sequence/protein sequence: | EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP |
| Protein accession: | Q04912 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RT-4 cell lysate with MST1R monoclonal antibody, clone CL0463 (Cat # MAB15629). |
| Applications: | WB-Ce |
| Shipping condition: | Dry Ice |