SDHB monoclonal antibody, clone CL0347 View larger

SDHB monoclonal antibody, clone CL0347

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SDHB monoclonal antibody, clone CL0347

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about SDHB monoclonal antibody, clone CL0347

Brand: Abnova
Reference: MAB15612
Product name: SDHB monoclonal antibody, clone CL0347
Product description: Mouse monoclonal antibody raised against partial recombinant human SDHB.
Clone: CL0347
Isotype: IgG1
Gene id: 6390
Gene name: SDHB
Gene alias: FLJ92337|IP|PGL4|SDH|SDH1|SDHIP
Gene description: succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Immunogen: Recombinant protein corresponding to human SDHB.
Immunogen sequence/protein sequence: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
Protein accession: P21912
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15612-46-346-1.jpg
Application image note: Western Blot analysis of RT-4 cell lysate with SDHB monoclonal antibody, clone CL0347 (Cat # MAB15612).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SDHB monoclonal antibody, clone CL0347 now

Add to cart