CTCF monoclonal antibody, clone CL0305 View larger

CTCF monoclonal antibody, clone CL0305

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTCF monoclonal antibody, clone CL0305

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about CTCF monoclonal antibody, clone CL0305

Brand: Abnova
Reference: MAB15598
Product name: CTCF monoclonal antibody, clone CL0305
Product description: Mouse monoclonal antibody raised against partial recombinant human CTCF.
Clone: CL0305
Isotype: IgG1
Gene id: 10664
Gene name: CTCF
Gene alias: -
Gene description: CCCTC-binding factor (zinc finger protein)
Immunogen: Recombinant protein corresponding to human CTCF.
Immunogen sequence/protein sequence: QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP
Protein accession: P49711
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15598-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with CTCF monoclonal antibody, clone CL0305 (Cat # MAB15598).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CTCF monoclonal antibody, clone CL0305 now

Add to cart