Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | MAB15594 |
Product name: | RBM3 monoclonal antibody, clone CL0296 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human RBM3. |
Clone: | CL0296 |
Isotype: | IgG1 |
Gene id: | 5935 |
Gene name: | RBM3 |
Gene alias: | IS1-RNPL|RNPL |
Gene description: | RNA binding motif (RNP1, RRM) protein 3 |
Immunogen: | Recombinant protein corresponding to human RBM3. |
Immunogen sequence/protein sequence: | DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY |
Protein accession: | P98179 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunofluorescent staining of U-2 OS cells with RBM3 monoclonal antibody, clone CL0296 (Cat # MAB15594) (Green) shows specific staining in the nucleoplasm. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | Low RBM3 protein expression correlates with clinical stage, prognostic classification and increased risk of treatment failure in testicular non-seminomatous germ cell cancer.Olofsson SE, Nodin B, Gaber A, Eberhard J, Uhlen M, Jirstrom K, Jerkeman M. PLoS One. 2015 Mar 26;10(3):e0121300. doi: 10.1371/journal.pone.0121300. eCollection 2015. |