PODXL monoclonal antibody, clone CL0285 View larger

PODXL monoclonal antibody, clone CL0285

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PODXL monoclonal antibody, clone CL0285

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about PODXL monoclonal antibody, clone CL0285

Brand: Abnova
Reference: MAB15592
Product name: PODXL monoclonal antibody, clone CL0285
Product description: Mouse monoclonal antibody raised against partial recombinant human PODXL.
Clone: CL0285
Isotype: IgG2b
Gene id: 5420
Gene name: PODXL
Gene alias: Gp200|MGC138240|PC|PCLP
Gene description: podocalyxin-like
Immunogen: Recombinant protein corresponding to human PODXL.
Immunogen sequence/protein sequence: LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
Protein accession: O00592
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15592-47-2-1.jpg
Application image note: Western Blot analysis of human kidney tissue lysate with PODXL monoclonal antibody, clone CL0285 (Cat # MAB15592).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PODXL monoclonal antibody, clone CL0285 now

Add to cart