RUNX2 monoclonal antibody, clone CL0232 View larger

RUNX2 monoclonal antibody, clone CL0232

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RUNX2 monoclonal antibody, clone CL0232

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about RUNX2 monoclonal antibody, clone CL0232

Brand: Abnova
Reference: MAB15571
Product name: RUNX2 monoclonal antibody, clone CL0232
Product description: Mouse monoclonal antibody raised against partial recombinant human RUNX2.
Clone: CL0232
Isotype: IgG2a
Gene id: 860
Gene name: RUNX2
Gene alias: AML3|CBFA1|CCD|CCD1|MGC120022|MGC120023|OSF2|PEA2aA|PEBP2A1|PEBP2A2|PEBP2aA|PEBP2aA1
Gene description: runt-related transcription factor 2
Immunogen: Recombinant protein corresponding to human RUNX2.
Immunogen sequence/protein sequence: LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Protein accession: Q13950
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15571-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with RUNX2 monoclonal antibody, clone CL0232 (Cat # MAB15571).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy RUNX2 monoclonal antibody, clone CL0232 now

Add to cart