Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce |
Brand: | Abnova |
Reference: | MAB15562 |
Product name: | NLRP3 monoclonal antibody, clone CL0210 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human NLRP3. |
Clone: | CL0210 |
Isotype: | IgG1 |
Gene id: | 114548 |
Gene name: | NLRP3 |
Gene alias: | AGTAVPRL|AII|AII/AVP|AVP|C1orf7|CIAS1|CLR1.1|FCAS|FCU|FLJ95925|MWS|NALP3|PYPAF1 |
Gene description: | NLR family, pyrin domain containing 3 |
Immunogen: | Recombinant protein corresponding to human NLRP3. |
Immunogen sequence/protein sequence: | FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR |
Protein accession: | Q96P20 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251 MG cell lysates with NLRP3 monoclonal antibody, clone CL0210 (Cat # MAB15562). |
Applications: | WB-Ce |
Shipping condition: | Dry Ice |