Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | MAB15558 |
Product name: | ANXA1 monoclonal antibody, clone CL0199 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human ANXA1. |
Clone: | CL0199 |
Isotype: | IgG1 |
Gene id: | 301 |
Gene name: | ANXA1 |
Gene alias: | ANX1|LPC1 |
Gene description: | annexin A1 |
Immunogen: | Recombinant protein corresponding to human ANXA1. |
Immunogen sequence/protein sequence: | FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV |
Protein accession: | P04083 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of U-251 MG cell lysate with ANXA1 monoclonal antibody, clone CL0199 (Cat # MAB15558). |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |