Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATAD2 monoclonal antibody, clone CL0182
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P |
More info about ATAD2 monoclonal antibody, clone CL0182
| Brand: | Abnova |
| Reference: | MAB15553 |
| Product name: | ATAD2 monoclonal antibody, clone CL0182 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human ATAD2. |
| Clone: | CL0182 |
| Isotype: | IgG1 |
| Gene id: | 29028 |
| Gene name: | ATAD2 |
| Gene alias: | ANCCA|DKFZp667N1320|MGC131938|MGC142216|MGC29843|MGC5254|PRO2000 |
| Gene description: | ATPase family, AAA domain containing 2 |
| Immunogen: | Recombinant protein corresponding to human ATAD2. |
| Immunogen sequence/protein sequence: | TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK |
| Protein accession: | Q6PL18 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of Lane 1: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells), Lane 2: negative control (vector only transfected HEK293T cell lysate) and Lane 3: U-251 cell lysate with ATAD2 monoclonal antibody, clone CL0182 (Cat # MAB15553). |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis.Wan WN, Zhang YX, Wang XM, Liu YJ, Zhang YQ, Que YH, Zhao WJ. Asian Pac J Cancer Prev. 2014;15(6):2777-83. |