Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,WB-Tr |
Brand: | Abnova |
Reference: | MAB15547 |
Product name: | CHGA monoclonal antibody, clone CL0166 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human CHGA. |
Clone: | CL0166 |
Isotype: | IgG1 |
Gene id: | 1113 |
Gene name: | CHGA |
Gene alias: | CGA |
Gene description: | chromogranin A (parathyroid secretory protein 1) |
Immunogen: | Recombinant protein corresponding to human CHGA. |
Immunogen sequence/protein sequence: | NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK |
Protein accession: | P10645 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with CHGA monoclonal antibody, clone CL0166 (Cat # MAB15547). |
Applications: | IHC-P,WB-Tr |
Shipping condition: | Dry Ice |