PTPRC monoclonal antibody, clone CL0159 View larger

PTPRC monoclonal antibody, clone CL0159

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPRC monoclonal antibody, clone CL0159

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about PTPRC monoclonal antibody, clone CL0159

Brand: Abnova
Reference: MAB15544
Product name: PTPRC monoclonal antibody, clone CL0159
Product description: Mouse monoclonal antibody raised against partial recombinant human PTPRC.
Clone: CL0159
Isotype: IgG1
Gene id: 5788
Gene name: PTPRC
Gene alias: B220|CD45|CD45R|GP180|LCA|LY5|T200
Gene description: protein tyrosine phosphatase, receptor type, C
Immunogen: Recombinant protein corresponding to human PTPRC.
Immunogen sequence/protein sequence: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
Protein accession: P08575
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15544-46-multi-1.jpg
Application image note: Western Blot analysis of Lane 1: Jurkat and Lane 2: MCF-7 cell lysates with PTPRC monoclonal antibody, clone CL0159 (Cat # MAB15544).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PTPRC monoclonal antibody, clone CL0159 now

Add to cart