Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | MAB15544 |
Product name: | PTPRC monoclonal antibody, clone CL0159 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human PTPRC. |
Clone: | CL0159 |
Isotype: | IgG1 |
Gene id: | 5788 |
Gene name: | PTPRC |
Gene alias: | B220|CD45|CD45R|GP180|LCA|LY5|T200 |
Gene description: | protein tyrosine phosphatase, receptor type, C |
Immunogen: | Recombinant protein corresponding to human PTPRC. |
Immunogen sequence/protein sequence: | KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT |
Protein accession: | P08575 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of Lane 1: Jurkat and Lane 2: MCF-7 cell lysates with PTPRC monoclonal antibody, clone CL0159 (Cat # MAB15544). |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |