Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | MAB15542 |
Product name: | ZEB1 monoclonal antibody, clone CL0151 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human ZEB1. |
Clone: | CL0151 |
Isotype: | IgG1 |
Gene id: | 6935 |
Gene name: | ZEB1 |
Gene alias: | AREB6|BZP|DELTA-EF1|MGC133261|NIL-2-A|NIL-2A|NIL2A|TCF8|ZEB|ZFHEP|ZFHX1A |
Gene description: | zinc finger E-box binding homeobox 1 |
Immunogen: | Recombinant protein corresponding to human ZEB1. |
Immunogen sequence/protein sequence: | EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST |
Protein accession: | P37275 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of A-549 cells with ZEB1 monoclonal antibody, clone CL0151 (Cat # MAB15542) (Green) shows nuclear (without nucleoli). Microtubule probes are visualized in red (where available). |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis.Varma S, Mahavadi P, Sasikumar S, Cushing L, Hyland T, Rosser AE, Riccardi D, Lu J, Kalin TV, Kalinichenko VV, Guenther A, Ramirez MI, Pardo A, Selman M, Warburton D. Am J Physiol Lung Cell Mol Physiol. 2014 Mar 1;306(5):L405-19. doi: 10.1152/ajplung.00143.2013. Epub 2013 Dec 27. |