Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SOX11 monoclonal antibody, clone CL0143
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,WB-Tr |
More info about SOX11 monoclonal antibody, clone CL0143
| Brand: | Abnova |
| Reference: | MAB15541 |
| Product name: | SOX11 monoclonal antibody, clone CL0143 |
| Product description: | Mouse monoclonal antibody raised against partial recombinant human SOX11. |
| Clone: | CL0143 |
| Isotype: | IgG2a |
| Gene id: | 6664 |
| Gene name: | SOX11 |
| Gene alias: | - |
| Gene description: | SRY (sex determining region Y)-box 11 |
| Immunogen: | Recombinant protein corresponding to human SOX11. |
| Immunogen sequence/protein sequence: | FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK |
| Protein accession: | P35716 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SOX11 monoclonal antibody, clone CL0143 (Cat # MAB15541). |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype.Ribera-Cortada I, Martinez D, Amador V, Royo C, Navarro A, Bea S, Gine E, de Leval L, Serrano S, Wotherspoon A, Colomer D, Martinez A, Campo E. Mod Pathol. 2015 Nov;28(11):1435-47. doi: 10.1038/modpathol.2015.99. Epub 2015 Sep 11. |