OCLN monoclonal antibody, clone CL1608 View larger

OCLN monoclonal antibody, clone CL1608

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OCLN monoclonal antibody, clone CL1608

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about OCLN monoclonal antibody, clone CL1608

Brand: Abnova
Reference: MAB15536
Product name: OCLN monoclonal antibody, clone CL1608
Product description: Mouse monoclonal antibody raised against partial recombinant human OCLN.
Clone: CL1608
Isotype: IgG1
Gene id: 100506658
Gene name: OCLN
Gene alias: BLCPMG|PPP1R115|PTORCH1
Gene description: occludin
Immunogen: Recombinant protein corresponding to amino acids 282-415 of human OCLN.
Immunogen sequence/protein sequence: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Protein accession: Q16625
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15536-46-multi-1.jpg
Application image note: Western Blot analysis of Lane 1: CACO-2 and Lane 2: U-87 cell lysates with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy OCLN monoclonal antibody, clone CL1608 now

Add to cart