Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce |
Brand: | Abnova |
Reference: | MAB15533 |
Product name: | MKL2 monoclonal antibody, clone CL1546 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human MKL2. |
Clone: | CL1546 |
Isotype: | IgG1 |
Gene id: | 57496 |
Gene name: | MKL2 |
Gene alias: | DKFZp686J1745|FLJ31823|FLJ45623|MRTF-B|NPD001 |
Gene description: | MKL/myocardin-like 2 |
Immunogen: | Recombinant protein corresponding to amino acids 136-273 of human MKL2. |
Immunogen sequence/protein sequence: | QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP |
Protein accession: | Q9ULH7 |
Form: | Liquid |
Recommend dilutions: | Western Blot (1:500 - 1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RT-4 cell lysates with MKL2 monoclonal antibody, clone CL1546 (Cat # MAB15533). |
Applications: | WB-Ce |
Shipping condition: | Dry Ice |