Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IHC-P |
Brand: | Abnova |
Reference: | MAB15531 |
Product name: | CD3E monoclonal antibody, clone CL1497 |
Product description: | Mouse monoclonal antibody raised against partial recombinant human CD3E. |
Clone: | CL1497 |
Isotype: | IgG1 |
Gene id: | 916 |
Gene name: | CD3E |
Gene alias: | FLJ18683|T3E|TCRE |
Gene description: | CD3e molecule, epsilon (CD3-TCR complex) |
Immunogen: | Recombinant protein corresponding to amino acids 25-126 of human CD3E. |
Immunogen sequence/protein sequence: | NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
Protein accession: | P07766 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500) Western Blot (1:500 - 1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Western Blot analysis of human tonsil tissue lysate with CD3E monoclonal antibody, clone CL1497 (Cat # MAB15531). |
Applications: | WB-Ti,IHC-P |
Shipping condition: | Dry Ice |