CD3E monoclonal antibody, clone CL1497 View larger

CD3E monoclonal antibody, clone CL1497

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD3E monoclonal antibody, clone CL1497

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about CD3E monoclonal antibody, clone CL1497

Brand: Abnova
Reference: MAB15531
Product name: CD3E monoclonal antibody, clone CL1497
Product description: Mouse monoclonal antibody raised against partial recombinant human CD3E.
Clone: CL1497
Isotype: IgG1
Gene id: 916
Gene name: CD3E
Gene alias: FLJ18683|T3E|TCRE
Gene description: CD3e molecule, epsilon (CD3-TCR complex)
Immunogen: Recombinant protein corresponding to amino acids 25-126 of human CD3E.
Immunogen sequence/protein sequence: NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Protein accession: P07766
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15531-47-5-1.jpg
Application image note: Western Blot analysis of human tonsil tissue lysate with CD3E monoclonal antibody, clone CL1497 (Cat # MAB15531).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CD3E monoclonal antibody, clone CL1497 now

Add to cart