View larger

APEX1 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APEX1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about APEX1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00000328-P01
Product name: APEX1 (Human) Recombinant Protein (P01)
Product description: Human APEX1 full-length ORF ( AAH02338, 1 a.a. - 318 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 328
Gene name: APEX1
Gene alias: APE|APE-1|APE1|APEN|APEX|APX|HAP1|REF-1|REF1
Gene description: APEX nuclease (multifunctional DNA repair enzyme) 1
Genbank accession: BC002338
Immunogen sequence/protein sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Protein accession: AAH02338
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000328-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Bcl2 inhibits abasic site repair by down-regulating APE1 endonuclease activity.Zhao J, Gao F, Zhang Y, Wei K, Liu Y, Deng X.
J Biol Chem. 2008 Apr 11;283(15):9925-32. Epub 2008 Feb 8.

Reviews

Buy APEX1 (Human) Recombinant Protein (P01) now

Add to cart