H00000322-Q01_25ug_25 ug
New product
Availability date:
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000322-Q01 |
Product name: | APBB1 (Human) Recombinant Protein (Q01) |
Product description: | Human APBB1 partial ORF ( AAH10854, 605 a.a. - 708 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 322 |
Gene name: | APBB1 |
Gene alias: | FE65|MGC:9072|RIR |
Gene description: | amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) |
Genbank accession: | BC010854 |
Immunogen sequence/protein sequence: | RFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP |
Protein accession: | AAH10854 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |