View larger

ANXA11 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANXA11 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ANXA11 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00000311-P01
Product name: ANXA11 (Human) Recombinant Protein (P01)
Product description: Human ANXA11 full-length ORF ( AAH07564, 1 a.a. - 505 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 311
Gene name: ANXA11
Gene alias: ANX11|CAP50
Gene description: annexin A11
Genbank accession: BC007564
Immunogen sequence/protein sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTRDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
Protein accession: AAH07564
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000311-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Prostate cancer biomarker annexin A3 detected in urines obtained following digital rectal examination presents antigenic variability.Hamelin-Peyron C, Vlaeminck-Guillem V, Haidous H, Schwall GP, Poznanovic S, Gorius-Gallet E, Michel S, Larue A, Guillotte M, Ruffion A, Choquet-Kastylevsky G, Ataman-Onal Y.
Clin Biochem. 2014 Jul;47(10-11):901-8.

Reviews

Buy ANXA11 (Human) Recombinant Protein (P01) now

Add to cart