Brand: | Abnova |
Reference: | H00002113-M02 |
Product name: | ETS1 monoclonal antibody (M02), clone 2G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ETS1. |
Clone: | 2G10 |
Isotype: | IgG2a Kappa |
Gene id: | 2113 |
Gene name: | ETS1 |
Gene alias: | ETS-1|EWSR2|FLJ10768 |
Gene description: | v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
Genbank accession: | BC017314 |
Immunogen: | ETS1 (AAH17314.1, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT |
Protein accession: | AAH17314.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged ETS1 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |