Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Brand: | Abnova |
Reference: | H00001748-M01 |
Product name: | DLX4 monoclonal antibody (M01), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DLX4. |
Clone: | 1F11 |
Isotype: | IgG2a Kappa |
Gene id: | 1748 |
Gene name: | DLX4 |
Gene alias: | BP1|DLX7|DLX8|DLX9 |
Gene description: | distal-less homeobox 4 |
Genbank accession: | BC016145 |
Immunogen: | DLX4 (AAH16145, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK |
Protein accession: | AAH16145 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody (M01), clone 1F11. Lane 1: DLX4 transfected lysate(26 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | DLX4 is associated with orofacial clefting and abnormal jaw development.Wu D, Mandal S, Choi A, Anderson A, Prochazkova M, Perry H, Gil-Da-Silva-Lopes VL, Lao R, Wan E, Tang PL, Kwok PY, Klein O, Zhuan B, Slavotinek AM. Hum Mol Genet. 2015 May 7. [Epub ahead of print] |