DLX4 monoclonal antibody (M01), clone 1F11 View larger

DLX4 monoclonal antibody (M01), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLX4 monoclonal antibody (M01), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about DLX4 monoclonal antibody (M01), clone 1F11

Brand: Abnova
Reference: H00001748-M01
Product name: DLX4 monoclonal antibody (M01), clone 1F11
Product description: Mouse monoclonal antibody raised against a partial recombinant DLX4.
Clone: 1F11
Isotype: IgG2a Kappa
Gene id: 1748
Gene name: DLX4
Gene alias: BP1|DLX7|DLX8|DLX9
Gene description: distal-less homeobox 4
Genbank accession: BC016145
Immunogen: DLX4 (AAH16145, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK
Protein accession: AAH16145
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001748-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001748-M01-13-15-1.jpg
Application image note: Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody (M01), clone 1F11.

Lane 1: DLX4 transfected lysate(26 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice
Publications: DLX4 is associated with orofacial clefting and abnormal jaw development.Wu D, Mandal S, Choi A, Anderson A, Prochazkova M, Perry H, Gil-Da-Silva-Lopes VL, Lao R, Wan E, Tang PL, Kwok PY, Klein O, Zhuan B, Slavotinek AM.
Hum Mol Genet. 2015 May 7. [Epub ahead of print]

Reviews

Buy DLX4 monoclonal antibody (M01), clone 1F11 now

Add to cart