Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001432-M02 |
Product name: | MAPK14 monoclonal antibody (M02), clone 1C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK14. |
Clone: | 1C9 |
Isotype: | IgG2b Kappa |
Gene id: | 1432 |
Gene name: | MAPK14 |
Gene alias: | CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA |
Gene description: | mitogen-activated protein kinase 14 |
Genbank accession: | NM_001315 |
Immunogen: | MAPK14 (NP_001306, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFN |
Protein accession: | NP_001306 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MAPK14 expression in transfected 293T cell line by MAPK14 monoclonal antibody (M02), clone 1C9. Lane 1: MAPK14 transfected lysate(41.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |