MAPK14 monoclonal antibody (M02), clone 1C9 View larger

MAPK14 monoclonal antibody (M02), clone 1C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK14 monoclonal antibody (M02), clone 1C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about MAPK14 monoclonal antibody (M02), clone 1C9

Brand: Abnova
Reference: H00001432-M02
Product name: MAPK14 monoclonal antibody (M02), clone 1C9
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPK14.
Clone: 1C9
Isotype: IgG2b Kappa
Gene id: 1432
Gene name: MAPK14
Gene alias: CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA
Gene description: mitogen-activated protein kinase 14
Genbank accession: NM_001315
Immunogen: MAPK14 (NP_001306, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFN
Protein accession: NP_001306
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001432-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001432-M02-13-15-1.jpg
Application image note: Western Blot analysis of MAPK14 expression in transfected 293T cell line by MAPK14 monoclonal antibody (M02), clone 1C9.

Lane 1: MAPK14 transfected lysate(41.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAPK14 monoclonal antibody (M02), clone 1C9 now

Add to cart