CKS2 monoclonal antibody (M01), clone 2H5-2C4 View larger

CKS2 monoclonal antibody (M01), clone 2H5-2C4

H00001164-M01_100ug_100 ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKS2 monoclonal antibody (M01), clone 2H5-2C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CKS2 monoclonal antibody (M01), clone 2H5-2C4

Brand: Abnova
Reference: H00001164-M01
Product name: CKS2 monoclonal antibody (M01), clone 2H5-2C4
Product description: Mouse monoclonal antibody raised against a full length recombinant CKS2.
Clone: 2H5-2C4
Isotype: IgG2b kappa
Gene id: 1164
Gene name: CKS2
Gene alias: CKSHS2
Gene description: CDC28 protein kinase regulatory subunit 2
Genbank accession: BC006458
Immunogen: CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Protein accession: AAH06458
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001164-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001164-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CKS2 monoclonal antibody (M01), clone 2H5-2C4 now

Add to cart