Reference: | H00056832-M01 |
Product name: | IFNK monoclonal antibody (M01), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IFNK. |
Clone: | 1B7 |
Isotype: | IgG2a Kappa |
Gene id: | 56832 |
Gene name: | IFNK |
Gene alias: | RP11-27J8.1 |
Gene description: | interferon, kappa |
Genbank accession: | NM_020124 |
Immunogen: | IFNK (NP_064509, 35 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCL |
Protein accession: | NP_064509 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |