Reference: | H00056302-M02 |
Product name: | TRPV5 monoclonal antibody (M02), clone 2A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPV5. |
Clone: | 2A6 |
Isotype: | IgG1 Kappa |
Gene id: | 56302 |
Gene name: | TRPV5 |
Gene alias: | CAT2|ECAC1|OTRPC3 |
Gene description: | transient receptor potential cation channel, subfamily V, member 5 |
Genbank accession: | NM_019841 |
Immunogen: | TRPV5 (NP_062815, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME |
Protein accession: | NP_062815 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |