Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STX18 monoclonal antibody (M13), clone 2E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about STX18 monoclonal antibody (M13), clone 2E5
| Reference: | H00053407-M13 |
| Product name: | STX18 monoclonal antibody (M13), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STX18. |
| Clone: | 2E5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 53407 |
| Gene name: | STX18 |
| Gene alias: | DKFZp686O15149|Ufe1 |
| Gene description: | syntaxin 18 |
| Genbank accession: | NM_016930 |
| Immunogen: | STX18 (NP_058626, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPA |
| Protein accession: | NP_058626 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |