Reference: | H00051703-M01 |
Product name: | ACSL5 monoclonal antibody (M01), clone 5H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACSL5. |
Clone: | 5H8 |
Isotype: | IgG1 Kappa |
Gene id: | 51703 |
Gene name: | ACSL5 |
Gene alias: | ACS2|ACS5|FACL5 |
Gene description: | acyl-CoA synthetase long-chain family member 5 |
Genbank accession: | NM_016234 |
Immunogen: | ACSL5 (NP_057318, 91 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS |
Protein accession: | NP_057318 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |