Cart 106 Product Products 22 811,16 € (empty)
No products
To be determined Shipping
22 811,16 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 106 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 22 811,16 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 22 811,16 €
Data sheet of TMOD2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about TMOD2 purified MaxPab rabbit polyclonal antibody (D01P)
| Reference: | H00029767-D01P |
| Product name: | TMOD2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TMOD2 protein. |
| Gene id: | 29767 |
| Gene name: | TMOD2 |
| Gene alias: | MGC39481|N-TMOD|NTMOD |
| Gene description: | tropomodulin 2 (neuronal) |
| Genbank accession: | NM_014548 |
| Immunogen: | TMOD2 (NP_055363.1, 1 a.a. ~ 351 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR |
| Protein accession: | NP_055363.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Shipping condition: | Dry Ice |