Reference: | H00026189-G01 |
Product name: | OR1A2 (Human) Recombinant Protein |
Product description: | Human OR1A2 full-length ORF (NP_036484.1) recombinant protein without tag. |
Gene id: | 26189 |
Gene name: | OR1A2 |
Gene alias: | MGC119930|MGC119931|OR17-6 |
Gene description: | olfactory receptor, family 1, subfamily A, member 2 |
Genbank accession: | NM_012352.1 |
Immunogen sequence/protein sequence: | MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLTGNLLIILAICADIRLHNPMYFLLANLSLVDIIFSSVTIPKVLANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAYDRAVAISCPLHYTTIMSPRSCILLIAGSWVIGNTSALPHTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFNVKMMYLGVGVFSLPLLCIIVSYVQVFSTVFQVPSTKSLFKAFCTCGSHLTVVFLYYGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQKLFSKRISS |
Protein accession: | NP_036484.1 |
Form: | Liquid |
Preparation method: | in vitro wheat germ expression system with proprietary liposome technology |
Recommend dilutions: | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage buffer: | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | None |
Shipping condition: | Dry Ice |