OR1A2 (Human) Recombinant Protein View larger

OR1A2 (Human) Recombinant Protein

New product

294,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OR1A2 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Func,Screening

More info about OR1A2 (Human) Recombinant Protein

Reference: H00026189-G01
Product name: OR1A2 (Human) Recombinant Protein
Product description: Human OR1A2 full-length ORF (NP_036484.1) recombinant protein without tag.
Gene id: 26189
Gene name: OR1A2
Gene alias: MGC119930|MGC119931|OR17-6
Gene description: olfactory receptor, family 1, subfamily A, member 2
Genbank accession: NM_012352.1
Immunogen sequence/protein sequence: MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLTGNLLIILAICADIRLHNPMYFLLANLSLVDIIFSSVTIPKVLANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAYDRAVAISCPLHYTTIMSPRSCILLIAGSWVIGNTSALPHTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFNVKMMYLGVGVFSLPLLCIIVSYVQVFSTVFQVPSTKSLFKAFCTCGSHLTVVFLYYGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQKLFSKRISS
Protein accession: NP_036484.1
Form: Liquid
Preparation method: in vitro wheat germ expression system with proprietary liposome technology
Recommend dilutions: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
Tag: None
Shipping condition: Dry Ice

Reviews

Buy OR1A2 (Human) Recombinant Protein now

Add to cart