RAB11FIP5 (Human) Recombinant Protein (Q01) View larger

RAB11FIP5 (Human) Recombinant Protein (Q01)

New product

294,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB11FIP5 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about RAB11FIP5 (Human) Recombinant Protein (Q01)

Reference: H00026056-Q01
Product name: RAB11FIP5 (Human) Recombinant Protein (Q01)
Product description: Human RAB11FIP5 partial ORF ( NP_056285.1, 554 a.a. - 652 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 26056
Gene name: RAB11FIP5
Gene alias: DKFZp434H018|GAF1|KIAA0857|RIP11|pp75
Gene description: RAB11 family interacting protein 5 (class I)
Genbank accession: NM_015470
Immunogen sequence/protein sequence: SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP
Protein accession: NP_056285.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

Reviews

Buy RAB11FIP5 (Human) Recombinant Protein (Q01) now

Add to cart