KLRK1 (Human) Recombinant Protein (P01) View larger

KLRK1 (Human) Recombinant Protein (P01)

New product

199,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLRK1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about KLRK1 (Human) Recombinant Protein (P01)

Reference: H00022914-P01
Product name: KLRK1 (Human) Recombinant Protein (P01)
Product description: Human KLRK1 full-length ORF ( NP_031386.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 22914
Gene name: KLRK1
Gene alias: CD314|D12S2489E|FLJ17759|FLJ75772|KLR|NKG2-D|NKG2D
Gene description: killer cell lectin-like receptor subfamily K, member 1
Genbank accession: NM_007360.1
Immunogen sequence/protein sequence: MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Protein accession: NP_031386.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

Reviews

Buy KLRK1 (Human) Recombinant Protein (P01) now

Add to cart