Reference: | H00011240-M01 |
Product name: | PADI2 monoclonal antibody (M01), clone 4D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PADI2. |
Clone: | 4D4 |
Isotype: | IgG1 Kappa |
Gene id: | 11240 |
Gene name: | PADI2 |
Gene alias: | KIAA0994|PAD-H19|PAD2|PDI2 |
Gene description: | peptidyl arginine deiminase, type II |
Genbank accession: | NM_007365 |
Immunogen: | PADI2 (NP_003008, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ |
Protein accession: | NP_003008 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |