Reference: | H00009949-P01 |
Product name: | AMMECR1 (Human) Recombinant Protein (P01) |
Product description: | Human AMMECR1 full-length ORF ( NP_001020751.1, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 9949 |
Gene name: | AMMECR1 |
Gene alias: | AMMERC1 |
Gene description: | Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 |
Genbank accession: | NM_001025580.1 |
Immunogen sequence/protein sequence: | MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS |
Protein accession: | NP_001020751.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Shipping condition: | Dry Ice |