Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MICAL2 (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Human |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about MICAL2 (Human) Recombinant Protein (Q01)
| Reference: | H00009645-Q01 |
| Product name: | MICAL2 (Human) Recombinant Protein (Q01) |
| Product description: | Human MICAL2 partial ORF ( NP_055447.1, 1021 a.a. - 1123 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 9645 |
| Gene name: | MICAL2 |
| Gene alias: | DKFZp686H03148|DKFZp686H2469|KIAA0750|MICAL2PV1|MICAL2PV2 |
| Gene description: | microtubule associated monoxygenase, calponin and LIM domain containing 2 |
| Genbank accession: | NM_014632 |
| Immunogen sequence/protein sequence: | FFHRECFRCSICATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLL |
| Protein accession: | NP_055447.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |