UBE2M (Human) Recombinant Protein (P01) View larger

UBE2M (Human) Recombinant Protein (P01)

New product

294,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2M (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about UBE2M (Human) Recombinant Protein (P01)

Reference: H00009040-P01
Product name: UBE2M (Human) Recombinant Protein (P01)
Product description: Human UBE2M full-length ORF ( AAH58924, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 9040
Gene name: UBE2M
Gene alias: UBC-RS2|UBC12|hUbc12
Gene description: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Genbank accession: BC058924
Immunogen sequence/protein sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Protein accession: AAH58924
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

Reviews

Buy UBE2M (Human) Recombinant Protein (P01) now

Add to cart